beta myosin heavy chain Search Results


rabbit anti myosin 7  (Proteintech)
96
Proteintech rabbit anti myosin 7
Rabbit Anti Myosin 7, supplied by Proteintech, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rabbit anti myosin 7/product/Proteintech
Average 96 stars, based on 1 article reviews
rabbit anti myosin 7 - by Bioz Stars, 2026-02
96/100 stars
  Buy from Supplier
β myosin heavy chain βmhc mm00600555  (Thermo Fisher)
86
Thermo Fisher β myosin heavy chain βmhc mm00600555
β Myosin Heavy Chain βmhc Mm00600555, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β myosin heavy chain βmhc mm00600555/product/Thermo Fisher
Average 86 stars, based on 1 article reviews
β myosin heavy chain βmhc mm00600555 - by Bioz Stars, 2026-02
86/100 stars
  Buy from Supplier
mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm  (Transgenic Rabbit Models)
90
Transgenic Rabbit Models mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm
Animal models of myofilament mutations causing diastolic heart failure
Mutant β Myosin Heavy Chain Glutamic Acid 403 Transgenic Rabbit Model Of Human Hcm, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm/product/Transgenic Rabbit Models
Average 90 stars, based on 1 article reviews
mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
transgenic rabbit β-myhc-q403  (Transgenic Rabbit Models)
90
Transgenic Rabbit Models transgenic rabbit β-myhc-q403
Genetically engineered animal models of HCM
Transgenic Rabbit β Myhc Q403, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/transgenic rabbit β-myhc-q403/product/Transgenic Rabbit Models
Average 90 stars, based on 1 article reviews
transgenic rabbit β-myhc-q403 - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)  (Peptide Protein Research Ltd)
90
Peptide Protein Research Ltd rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)
Genetically engineered animal models of HCM
Rlc Binding Site Peptide Of The Human β Cardiac Myosin Heavy Chain Encompassing Amino Acids 805–837 (Errdsllviqwnirafmgvknwpwmklyfkik), supplied by Peptide Protein Research Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)/product/Peptide Protein Research Ltd
Average 90 stars, based on 1 article reviews
rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik) - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
primary antibody against sarcomeric beta-myosin heavy chain  (Novocastra)
90
Novocastra primary antibody against sarcomeric beta-myosin heavy chain
Genetically engineered animal models of HCM
Primary Antibody Against Sarcomeric Beta Myosin Heavy Chain, supplied by Novocastra, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/primary antibody against sarcomeric beta-myosin heavy chain/product/Novocastra
Average 90 stars, based on 1 article reviews
primary antibody against sarcomeric beta-myosin heavy chain - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
β-myosin heavy chain or β-mhc  (Enzo Biochem)
90
Enzo Biochem β-myosin heavy chain or β-mhc
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain Or β Mhc, supplied by Enzo Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain or β-mhc/product/Enzo Biochem
Average 90 stars, based on 1 article reviews
β-myosin heavy chain or β-mhc - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
beta myosin heavy chain  (ClinGen Resource)
90
ClinGen Resource beta myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Beta Myosin Heavy Chain, supplied by ClinGen Resource, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/beta myosin heavy chain/product/ClinGen Resource
Average 90 stars, based on 1 article reviews
beta myosin heavy chain - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
mab beta myosin heavy chain  (Absolute Biotech Inc)
90
Absolute Biotech Inc mab beta myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Mab Beta Myosin Heavy Chain, supplied by Absolute Biotech Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mab beta myosin heavy chain/product/Absolute Biotech Inc
Average 90 stars, based on 1 article reviews
mab beta myosin heavy chain - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
β-myosin heavy chain (β-mhc  (Qiagen)
90
Qiagen β-myosin heavy chain (β-mhc
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain (β Mhc, supplied by Qiagen, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain (β-mhc/product/Qiagen
Average 90 stars, based on 1 article reviews
β-myosin heavy chain (β-mhc - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
β-myosin heavy chain  (ALFARES Pharmaceuticals)
90
ALFARES Pharmaceuticals β-myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain, supplied by ALFARES Pharmaceuticals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain/product/ALFARES Pharmaceuticals
Average 90 stars, based on 1 article reviews
β-myosin heavy chain - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation  (MAICON ASSOCIATES LIMITED)
90
MAICON ASSOCIATES LIMITED reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Reduced Beta Myosin Heavy Chain K213 Acetylation And T215 Phosphorylation, supplied by MAICON ASSOCIATES LIMITED, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation/product/MAICON ASSOCIATES LIMITED
Average 90 stars, based on 1 article reviews
reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier

Image Search Results


Animal models of myofilament mutations causing diastolic heart failure

Journal: Heart Failure Reviews

Article Title: Myofilament dysfunction in diastolic heart failure

doi: 10.1007/s10741-023-10352-z

Figure Lengend Snippet: Animal models of myofilament mutations causing diastolic heart failure

Article Snippet: , MYH7 , β-MyHC (myosin mutation R723G) , Thick filament (Cardiac ventricles; slow-twitch skeletal muscle) , mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human HCM , [ ] .

Techniques: Animal Model, Knock-Out, Mutagenesis, Transgenic Assay, Activity Assay

Genetically engineered animal models of HCM

Journal:

Article Title: Molecular genetics and pathogenesis of hypertrophic cardiomyopathy

doi:

Figure Lengend Snippet: Genetically engineered animal models of HCM

Article Snippet: After 6 months of exercise hypertrophy, myofibrillar disarray 105 Transgenic rabbit β-MyHC-Q403 Cardiac hypertrophy, myocyte disarray, interstitial fibrosis, increased mortality and SCD, systolic and diastolic dysfunction, preserved global systolic function, reduced myocardial contraction and relaxation velocities 106 , 118 Open in a separate window [Ca +2 ]I: Intracellular Ca +2 concentration; [PCr]: phosphocreatinine; ↑[Pi]: Inorganic phosphate; −/−: null (homozygous for the deletion); +/−: heterozygous, LCBD: Light chain binding domain, MyHC: myosin heavy chain; cTnT: Cardiac troponin T: cTnI: Cardiac troponin I; MyBP-C: Myosin binding protein C, ELC: Essential light chain.

Techniques: Activity Assay, Knock-Out, Transgenic Assay, Expressing

A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, β-MHC and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.

Journal: PLoS ONE

Article Title: Hydrogen Sulfide Suppresses Outward Rectifier Potassium Currents in Human Pluripotent Stem Cell-Derived Cardiomyocytes

doi: 10.1371/journal.pone.0050641

Figure Lengend Snippet: A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, β-MHC and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.

Article Snippet: Sigma), β-myosin heavy chain or β-MHC (Alexis Biochemicals, FL, USA) followed by Alexa Fluo® 488 goat anti-rabbit IgG (Invitrogen, CA, USA); and cardiac Titin (1∶10) (Sigma-Alrich, MO, USA) followed by Alexa Fluo® 555 donkey anti-rabbit IgG.

Techniques: Light Microscopy, Immunocytochemistry, Staining, Derivative Assay